Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCP11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP15769820UL
Description
TCP11 Polyclonal specifically detects TCP11 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockout Validated.Specifications
TCP11 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q8WWU5 | |
TCP11 | |
Synthetic peptides corresponding to TCP11(t-complex 11 homolog (mouse)) The peptide sequence was selected from the middle region of TCP11 (NP_061149). Peptide sequence CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNL. | |
Affinity Purified | |
RUO | |
6954 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
D6S230E, KIAA0229, MGC111103, t-complex 11 (a murine tcp homolog), t-complex 11 homolog (mouse), T-complex protein 11 homolog | |
Rabbit | |
56 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction