Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TCP11 Antibody, Novus Biologicals™

TCP11 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15769820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15769820 20 μL
NBP157698 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15769820 Supplier Novus Biologicals Supplier No. NBP15769820UL

Description

Rabbit Polyclonal Antibody has been used in 2 publications

TCP11 Polyclonal specifically detects TCP11 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockout Validated.

Specifications

Antigen TCP11
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8WWU5
Gene Alias D6S230E, KIAA0229, MGC111103, t-complex 11 (a murine tcp homolog), t-complex 11 homolog (mouse), T-complex protein 11 homolog
Gene Symbols TCP11
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TCP11(t-complex 11 homolog (mouse)) The peptide sequence was selected from the middle region of TCP11 (NP_061149). Peptide sequence CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNL.
Molecular Weight of Antigen 56 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6954
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.