Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCTEX1D4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TCTEX1D4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TCTEX1D4 Polyclonal specifically detects TCTEX1D4 in Human samples. It is validated for Western Blot.Specifications
TCTEX1D4 | |
Polyclonal | |
Rabbit | |
Tctex1 domain containing 4 | |
TCTEX1D4 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
343521 | |
Synthetic peptides corresponding to RP11-269F19.9 (Tctex1 domain containing 4) The peptide sequence was selected from the middle region of RP11-269F19.9. Peptide sequence VCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYC. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title