Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TDRD12 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | TDRD12 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TDRD12 Polyclonal specifically detects TDRD12 in Human samples. It is validated for Western Blot.Specifications
| TDRD12 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| ECAT8, ES cell associated transcript 8, ES cell-associated transcript 8 protein, FLJ13072, tudor domain containing 12, tudor domain-containing protein 12 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human TDRD12 (NP_001104292). Peptide sequence DKAVKCNMDSLRDSPKDKSEKKHHCISLKDTNKRVESSVYWPAKRGITIY | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 91646 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title