TDRD6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP321396100UL

Catalog No. NB237985

Description

TDRD6 Polyclonal antibody specifically detects TDRD6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: TDRD6
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: Antigen NY-CO-45, bA446F17.4, Cancer/testis antigen 41.2, CT41.2FLJ43850, DKFZp781I1148, NY-CO-45, TDR2, tudor domain containing 6, tudor domain-containing protein 6, tudor repeat 2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: INSSYKELKLLQSLTKTNLVTQYQDSVGNKNSQVFPLTTEKKEEISAETPLKTARVEATLSERKIGDSCDKDLPLKFCEFPQKTI
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 221400
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG