Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TDRD9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TDRD9 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TDRD9 Polyclonal specifically detects TDRD9 in Human samples. It is validated for Western Blot.Specifications
TDRD9 | |
Polyclonal | |
Rabbit | |
C14orf75, chromosome 14 open reading frame 75, DKFZp434N0820, EC 3.6.1, EC 3.6.4.13, FLJ36164, HIG-1, hypoxia-inducible HIG-1, MGC135025, NET54, putative ATP-dependent RNA helicase TDRD9, tudor domain containing 9, Tudor domain-containing protein 9 | |
TDRD9 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
122402 | |
Synthetic peptides corresponding to TDRD9(tudor domain containing 9) The peptide sequence was selected from the middle region of TDRD9. Peptide sequence AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPM. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title