Invitrogen™ Tec Polyclonal Antibody

Catalog No.	Quantity
PIPA5114365	100 μg

Catalog No. PIPA5114365 Supplier Invitrogen™ Supplier No. PA5114365

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HEL whole cell, human THP-1 whole cell, rat kidney tissue, mouse kidney tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

TEC is a non-receptor protein-tyrosine kinase containing a pleckstrin homology domain and is highly expressed in many hematopoietic cell lines. They are also key players in the regulation of the immune functions. Tec kinase is an integral component of T cell signaling and has a distinct role in T cell activation. This gene may be associated with myelodysplastic syndrome.

Specifications

• Antigen: Tec
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: Tec
• Gene Accession No.: P24604, P42680
• Gene Alias: cytoplasmic tyrosine kinase, Dscr28C related; MGC126760; MGC126762; PSCTK4; TEC; tec protein tyrosine kinase; tyrosine-protein kinase Tec
• Gene Symbols: Tec
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence of human Tec (HDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPK).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 100124696, 21682, 7006, 84492
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG