Invitrogen™ TECTA Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA580102

Catalog No. PIPA580102

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat testis tissue, mouse HEPA1-6 whole cell, human HepG2 whole cell. IHC: human intetsinal cancer tissue, human lung cancer tissue, human testis tissue.

Alpha-tectorin is a protein that in humans is encoded by the TECTA gene. The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness.

Specifications

• Antigen: TECTA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Tecta
• Gene Alias: [a]-tectorin; alpha-tectorin; DFNA12; DFNA8; DFNB21; Tctna; TECTA; tectorin alpha
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 21683, 300653, 7007
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: O08523, O75443
• Gene Symbols: Tecta
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TECTA (93-134aa RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG