Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TEN1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
Antigen | TEN1 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
TEN1 Polyclonal specifically detects TEN1 in Mouse samples. It is validated for Western Blot.Specifications
TEN1 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Mouse | |
C17orf106, CST complex subunit TEN1, FLJ39785, MGC54300, protein telomeric pathways with STN1 homolog, telomere length regulation protein TEN1 homolog, telomeric pathways in association with Stn1, number 1, TEN1 telomerase capping complex subunit homolog (S. cerevisiae) | |
The immunogen is a synthetic peptide directed towards the N terminal region of Mouse TEN1 (NP_081383.1). Peptide sequence GSTLRTFGRLYLYDMARSLMTLAAPQKPDQCQLLVCTNLVEPFEAHVNFL | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
100134934 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title