Tensin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 5 publications

Catalog Number	Mfr. No.	Quantity
NB432822	Novus Biologicals NBP18412925UL	25 μL
NBP184129	Novus Biologicals NBP184129	0.1 mL

Description

Tensin 1 Polyclonal specifically detects Tensin 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Tensin 1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: DKFZp586K0617, matrix-remodelling associated 6, Matrix-remodelling-associated protein 6, MGC88584, MST091, MST122, MST127, MSTP127, MXRA6, tensin, tensin 1, tensin-1, TNSMSTP122
• Gene Symbols: TNS1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human Tensin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot Reported in scientific literature (PMID: 30813060)., Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence Reactivity reported in (PMID: 25766369). , Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cell Cycle and Replication, Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 7145
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only