Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Tensin 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$337.75 - $627.50
Specifications
| Antigen | Tensin 1 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Tensin 1 Polyclonal specifically detects Tensin 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| Tensin 1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| RUO | |
| Human | |
| DKFZp586K0617, matrix-remodelling associated 6, Matrix-remodelling-associated protein 6, MGC88584, MST091, MST122, MST127, MSTP127, MXRA6, tensin, tensin 1, tensin-1, TNSMSTP122 | |
| TNS1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 7145 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LSPLTNGLDKSYPMEPMVNGGGYPYESASRAGPAHAGHTAPMRPSYSAQEGLAGYQREGPHPAWPQPVTTSHYAHDPSGMFRSQS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title