Testisin/Prss21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179539

Catalog No. NBP179539

Description

Testisin/Prss21 Polyclonal specifically detects Testisin/Prss21 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Testisin/Prss21
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4.21, Eosinophil serine protease 1, ESP1EC 3.4.21.-, ESP-1serine protease from eosinophils, protease, serine, 21 (testisin), Serine protease 21, TEST1testisin, TESTISIN
• Host Species: Rabbit
• Molecular Weight of Antigen: 33 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Pig: 83%; Guinea pig: 83%.
• Target Species: Human, Mouse, Rat, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_659206
• Gene Symbols: PRSS21
• Immunogen: Synthetic peptide directed towards the N terminal of human PRSS21. Peptide sequence RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10942
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.