Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Testisin/Prss21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17953920UL
Description
Testisin/Prss21 Polyclonal specifically detects Testisin/Prss21 in Human samples. It is validated for Western Blot.Specifications
Testisin/Prss21 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_659206 | |
PRSS21 | |
Synthetic peptide directed towards the N terminal of human PRSS21. Peptide sequence RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF. | |
Affinity Purified | |
RUO | |
10942 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 3.4.21, Eosinophil serine protease 1, ESP1EC 3.4.21.-, ESP-1serine protease from eosinophils, protease, serine, 21 (testisin), Serine protease 21, TEST1testisin, TESTISIN | |
Rabbit | |
33 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction