Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Tetraspanin-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$512.00

Specifications

Antigen	Tetraspanin-4
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP159438 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159438	100 μL	Each of 1 for $512.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Tetraspanin-4 Polyclonal specifically detects Tetraspanin-4 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen	Tetraspanin-4
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	Novel antigen 2, TETRASPAN, tetraspanin 4, tetraspanin-4, Transmembrane 4 superfamily member 7NAG-2NAG2TM4SF7tetraspan TM4SF, TSPAN-4
Gene Symbols	TSPAN4
Isotype	IgG
Molecular Weight of Antigen	26 kDa

Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	O14817
Gene ID (Entrez)	7106
Immunogen	Synthetic peptides corresponding to TSPAN4 (tetraspanin 4) The peptide sequence was selected from the middle region of TSPAN4) Peptide sequence YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW (NP_001020405).
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Tetraspanin-4 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents