Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Tetraspanin-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$530.25
Specifications
| Antigen | Tetraspanin-4 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
Tetraspanin-4 Polyclonal specifically detects Tetraspanin-4 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| Tetraspanin-4 | |
| Unconjugated | |
| RUO | |
| Novel antigen 2, TETRASPAN, tetraspanin 4, tetraspanin-4, Transmembrane 4 superfamily member 7NAG-2NAG2TM4SF7tetraspan TM4SF, TSPAN-4 | |
| TSPAN4 | |
| IgG | |
| 26 kDa |
| Polyclonal | |
| Rabbit | |
| O14817 | |
| 7106 | |
| Synthetic peptides corresponding to TSPAN4 (tetraspanin 4) The peptide sequence was selected from the middle region of TSPAN4) Peptide sequence YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW (NP_001020405). | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title