Tetraspanin-5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169337

Catalog No. NBP169337

Description

Tetraspanin-5 Polyclonal specifically detects Tetraspanin-5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Tetraspanin-5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: member 8, tetraspanin 5
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge lyophilized antibody at 12,000 x g for 20 seconds. Add sterile, distilled water to achieve a final antibody concentration of 1mg/mL (for 100ug samples, add 100uL of dH2O).
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P62079
• Gene Symbols: TSPAN5
• Immunogen: Synthetic peptides corresponding to TSPAN5(tetraspanin 5) The peptide sequence was selected from the middle region of TSPAN5. Peptide sequence ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10098
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only