Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TEX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | TEX2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15997720
|
Novus Biologicals
NBP15997720UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP159977
|
Novus Biologicals
NBP159977 |
100 μL |
Each for $487.50
|
|
|||||
Description
TEX2 Polyclonal specifically detects TEX2 in Human samples. It is validated for Western Blot.Specifications
| TEX2 | |
| Polyclonal | |
| Rabbit | |
| Q8IWB9 | |
| 55852 | |
| Synthetic peptides corresponding to TEX2(testis expressed 2) The peptide sequence was selected from the N terminal of TEX2. Peptide sequence KSLSTEVEPKESPHPARHRHLMKTLVKSLSTDTSRQESDTVSYKPPDSKL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| HT008, KIAA1738DKFZp781G0721, testis expressed 2, testis expressed sequence 2, testis-expressed sequence 2 protein, TMEM96, transmembrane protein 96 | |
| TEX2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title