TFB1M Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310330100UL

Catalog No. NB125561

Description

TFB1M Polyclonal specifically detects TFB1M in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: TFB1M
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Alias: CGI75, CGI-75, dimethyladenosine transferase 1, mitochondrial, EC 2.1.1, EC 2.1.1.-, h-mtTFB, h-mtTFB1, homolog of yeast mitochondrial transcription factor B, hTFB1M, Mitochondrial 12S rRNA dimethylase 1, mitochondrial dimethyladenosine transferase 1, Mitochondrial transcription factor B1, mtTFB, mtTFB1, S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase 1, transcription factor B1, mitochondrial
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFB1M (NP_057104). Peptide sequence NFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGGITRSILNADVAELLVVE
• Quantity: 100 μg
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 51106
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified