Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TFB1M Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310330100UL
Description
TFB1M Polyclonal specifically detects TFB1M in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
TFB1M | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
CGI75, CGI-75, dimethyladenosine transferase 1, mitochondrial, EC 2.1.1, EC 2.1.1.-, h-mtTFB, h-mtTFB1, homolog of yeast mitochondrial transcription factor B, hTFB1M, Mitochondrial 12S rRNA dimethylase 1, mitochondrial dimethyladenosine transferase 1, Mitochondrial transcription factor B1, mtTFB, mtTFB1, S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase 1, transcription factor B1, mitochondrial | |
The immunogen is a synthetic peptide directed towards the N terminal region of human TFB1M (NP_057104). Peptide sequence NFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGGITRSILNADVAELLVVE | |
100 μg | |
Stem Cell Markers | |
51106 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction