Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TFB2M Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25509525UL
Description
TFB2M Polyclonal specifically detects TFB2M in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
TFB2M | |
Polyclonal | |
Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
dimethyladenosine transferase 2, mitochondrial, EC 2.1.1.-, FLJ22661, FLJ23182, HCV NS5A-transactivated protein 5, Hepatitis C virus NS5A-transactivated protein 5, Hkp1, h-mtTFB, h-mtTFB2, hTFB2M, Mitochondrial 12S rRNA dimethylase 2, Mitochondrial transcription factor B2, mtTFB2, NS5ATP5, S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase 2, transcription factor B2, mitochondrial | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
TFB2M | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNPPRKASKASLDFKRYVTDRRLAETL | |
25 μL | |
metabolism | |
64216 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction