Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TFF1/pS2 Antibody, Novus Biologicals™

TFF1/pS2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP190813 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP190813 0.1 mL
NB430135 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP190813 Supplier Novus Biologicals Supplier No. NBP190813
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 4 publications

TFF1/pS2 Polyclonal specifically detects TFF1/pS2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen TFF1/pS2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000-1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias BCEIbreast cancer, estrogen-inducible sequence expressed in, Breast cancer estrogen-inducible protein, breast cancer estrogen-inducible sequence, D21S21, gastrointestinal trefoil protein pS2, hP1.A, HPS2, pNR-2, Polypeptide P1.A, Protein pS2, pS2, trefoil factor 1, trefoil factor, BCE1, human pS2 induced by estrogen from human breast cancercell line M10HP1.A
Gene Symbols TFF1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer
Primary or Secondary Primary
Gene ID (Entrez) 7031
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.