TFIIE beta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310905100UL

Catalog No. NB126709

Description

TFIIE beta Polyclonal specifically detects TFIIE beta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TFIIE beta
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Alias: FE, General transcription factor IIE subunit 2, general transcription factor IIE, polypeptide 2 (beta subunit, 34kD), general transcription factor IIE, polypeptide 2, beta 34kDa, TF2E2TFIIE-beta, TFIIE-B, transcription initiation factor IIE subunit beta
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFIIE beta (NP_002086). Peptide sequence VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRG
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2961
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.