Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TFIIE beta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310905100UL
Description
TFIIE beta Polyclonal specifically detects TFIIE beta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TFIIE beta | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
FE, General transcription factor IIE subunit 2, general transcription factor IIE, polypeptide 2 (beta subunit, 34kD), general transcription factor IIE, polypeptide 2, beta 34kDa, TF2E2TFIIE-beta, TFIIE-B, transcription initiation factor IIE subunit beta | |
The immunogen is a synthetic peptide directed towards the N terminal region of human TFIIE beta (NP_002086). Peptide sequence VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRG | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
2961 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction