Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TGF-beta 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159437
Description
TGF-beta 2 Polyclonal antibody specifically detects TGF-beta 2 in Human, Mouse samples. It is validated for Western Blot.Specifications
| TGF-beta 2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| BSC-1 cell growth inhibitor, Cetermin, Glioblastoma-derived T-cell suppressor factor, G-TSF, MGC116892, Polyergin, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, transforming growth factor, beta 2 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Xenopus: 92%; Guinea pig: 92%; Zebrafish: 92%; Chicken: 78%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P61812 | |
| TGFB2 | |
| Synthetic peptides corresponding to TGFB2 (transforming growth factor, beta 2) The peptide sequence was selected from the middle region of TGFB2)(50ug). Peptide sequence NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT. | |
| 100 μL | |
| Angiogenesis, Apoptosis, Cell Cycle and Replication | |
| 7042 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction