Invitrogen™ TGFBR1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595387

Catalog No. PIPA595387

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat cardiac muscle tissue, mouse liver tissue, HELA whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

TGFBR1 is a transmembrane serine/threonine kinase in the TGFBR1 superfamily, which also includes ACVRs and BMPRs. Upon binding TGF-b, TGFBR2 dimerizes with and activates TGFBR1 via phosphorylation leading to downstream phosphorylation of SMADs by TGFBR1. TGFBR1 forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS).

Specifications

• Antigen: TGFBR1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: TGFBR1
• Gene Alias: AAT5; activin A receptor type II-like kinase, 53kDa; activin A receptor type II-like protein kinase of 53kD; Activin receptor-like kinase 5; ACVRLK4; ALK5; Alk-5; AU017191; ESK2; ESS1; LDS1; LDS1A; LDS2A; MSSE; mutant transforming growth factor beta receptor I; ser; serine/threonine-protein kinase receptor R4; SKR4; TbetaRI; tbetaR-I; tgf beta receptor 1; TGF-beta receptor type I; TGF-beta receptor type-1; TGF-beta type I receptor; TGFBR1; TGFR1; TGFR-1; Transfor; transforming growth factor beta receptor 1; transforming growth factor beta receptor I; transforming growth factor, beta receptor 1; transforming growth factor, beta receptor I; transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kDa); transforming growth factor-beta receptor type I
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 21812, 29591, 7046
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P36897, P80204, Q64729
• Gene Symbols: TGFBR1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov