Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
THEG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | THEG |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
THEG Polyclonal specifically detects THEG in Human samples. It is validated for Western Blot.Specifications
THEG | |
Polyclonal | |
Rabbit | |
NP_954672 | |
51298 | |
Synthetic peptide directed towards the middle region of human THEG. Peptide sequence: LKDRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTT | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CT56Cancer/testis antigen 56, MGC26138, testis-specific, Theg homolog, Theg homolog (mouse) | |
THEG | |
IgG | |
41 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title