Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Thioredoxin-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Thioredoxin-2 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
Thioredoxin-2 Polyclonal specifically detects Thioredoxin-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Thioredoxin-2 | |
| Unconjugated | |
| RUO | |
| Q99757 | |
| 25828 | |
| Synthetic peptides corresponding to TXN2(thioredoxin 2) The peptide sequence was selected from the middle region of TXN2 (NP_036605). Peptide sequence VDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Breast Cancer | |
| mitochondrial thioredoxin, MTRX, MT-TRX, thioredoxin 2, thioredoxin, mitochondrial, thioredoxin-2, TRX2 | |
| TXN2 | |
| IgG | |
| 12 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title