Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
THNSL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | THNSL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
THNSL2 Polyclonal specifically detects THNSL2 in Human samples. It is validated for Western Blot.Specifications
| THNSL2 | |
| Polyclonal | |
| Rabbit | |
| FLJ10916, FLJ35504, secreted osteoclastogenic factor of activated T cells, SOFAT, threonine synthase-like 2 (S. cerevisiae), THS2, TSH2 | |
| THNSL2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 55258 | |
| Synthetic peptides corresponding to THNSL2(threonine synthase-like 2 (S. cerevisiae)) The peptide sequence was selected from the middle region of THNSL2. Peptide sequence LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title