Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
THOC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | THOC3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
THOC3 Polyclonal specifically detects THOC3 in Human samples. It is validated for Western Blot.Specifications
THOC3 | |
Polyclonal | |
Rabbit | |
Core ESC Like Genes, Stem Cell Markers | |
hTREX45, MGC5469, TEX1 homolog, TEX1THO complex subunit 3, THO complex 3, tho3 | |
THOC3 | |
IgG | |
This product is specific to Subunit or Isoform: 3. |
Western Blot | |
Unconjugated | |
RUO | |
Q96J01 | |
84321 | |
Synthetic peptides corresponding to THOC3(THO complex 3) The peptide sequence was selected from the middle region of THOC3. Peptide sequence LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title