Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Thromboxane A2 R/TBXA2R Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31056125UL
Description
Thromboxane A2 R/TBXA2R Polyclonal specifically detects Thromboxane A2 R/TBXA2R in Human samples. It is validated for Western Blot.Specifications
Thromboxane A2 R/TBXA2R | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Prostanoid TP receptor, thromboxane A2 receptor, TXA2-R | |
The immunogen is a synthetic peptide directed towards the C-terminal region of human Thromboxane A2 R/TBXA2R (NP_001051.1). Peptide sequence EYSGAISAHCNLRLPGSSDSSASACQVAGTTGTRPSWMQPPCLPSRWWAS | |
25 μg | |
GPCR | |
6915 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction