Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Thromboxane synthase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP23394625UL
Description
Thromboxane synthase Polyclonal specifically detects Thromboxane synthase in Human, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Thromboxane synthase | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
P24557 | |
TBXAS1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: RGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIP | |
25 μL | |
Lipid and Metabolism | |
6916 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CYP5A1family 5, subfamily A, polypeptide 1, CYP5FLJ52771, EC 5.3.99.5, GHOSAL, platelet, cytochrome P450, subfamily V, thromboxane A synthase 1 (platelet), thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A), thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V), thromboxane-A synthase, TXA synthase | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction