Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Thromboxane synthase Antibody, Novus Biologicals™
SDP

Catalog No. NB436698 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436698 25 μL
NBP233946 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436698 Supplier Novus Biologicals Supplier No. NBP23394625UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 1 publication

Thromboxane synthase Polyclonal specifically detects Thromboxane synthase in Human, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Thromboxane synthase
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P24557
Gene Alias CYP5A1family 5, subfamily A, polypeptide 1, CYP5FLJ52771, EC 5.3.99.5, GHOSAL, platelet, cytochrome P450, subfamily V, thromboxane A synthase 1 (platelet), thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A), thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V), thromboxane-A synthase, TXA synthase
Gene Symbols TBXAS1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIP
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 6916
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.