Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
THSD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP325189
Description
THSD1 Polyclonal antibody specifically detects THSD1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
THSD1 | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
thrombospondin type-1 domain-containing protein 1, thrombospondin, type I, domain 1, thrombospondin, type I, domain containing 1,4833423O18Rik, TMTSPMGC74971, Transmembrane molecule with thrombospondin module, UNQ3010 | |
This antibody has been engineered to specifically recognize the recombinant protein THSD1 using the following amino acid sequence: KSQARHVGSRGGPSERSHARNAHFRRTASFHEARQARPFRERSMSTLTPRQAPAYSSRTRTCEQAEDRFRPQSRGAHLFPEKLEHFQEASGTRGPLN | |
100 μL | |
Cancer | |
55901 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction