Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Thymidylate Synthase Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP31700425UL

 View more versions of this product

Catalog No. NB169085


Only null left
Add to Cart
This item is not returnable. View return policy

Description

Description

Thymidylate Synthase Polyclonal antibody specifically detects Thymidylate Synthase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

Thymidylate Synthase
Polyclonal
Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
EC 2.1.1.45, HsT422, MGC88736, thymidylate synthase, thymidylate synthetase, TMSTsase, TSase, TSHST422
This antibody was developed against Recombinant Protein corresponding to amino acids: SSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDD
25 μg
Cancer, Cell Cycle and Replication, DNA Repair, DNA replication Transcription Translation and Splicing, Transcription Factors and Regulators, Translation Control
7298
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
IgG
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.