Thyroid receptor-interacting protein 11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25741525UL

Catalog No. NB393977

Description

Thyroid receptor-interacting protein 11 Polyclonal specifically detects Thyroid receptor-interacting protein 11 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Thyroid receptor-interacting protein 11
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CEV14TR-interacting protein 11, Clonal evolution-related gene on chromosome 14 protein, GMAP-210ACG1A, Golgi-associated microtubule-binding protein 210, Golgi-microtubule-associated protein of 210 kDa, thyroid hormone receptor interactor 11, thyroid receptor-interacting protein 11, TRIP-11, Trip230
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9321
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TRIP11
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSILGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSV
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only