Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TIA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25496225UL
Description
TIA1 Polyclonal specifically detects TIA1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
TIA1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
cytotoxic granule-associated RNA-binding protein, nucleolysin TIA-1 isoform p40, p40-TIA-1, p40-TIA-1 (containing p15-TIA-1), RNA-binding protein TIA-1, T-cell-restricted intracellular antigen-1, TIA-1, TIA1 cytotoxic granule-associated RNA binding protein, TIA1 cytotoxic granule-associated RNA-binding protein | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
TIA1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRV | |
25 μL | |
Adaptive Immunity, Apoptosis, Immunology | |
7072 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction