TICRR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258491

Catalog No. NBP258491

Description

TICRR Polyclonal specifically detects TICRR in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: TICRR
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: C15orf42, Chromosome 15 Open Reading Frame 42, SLD3, SLD3 Homolog, SLD3 Homolog (S. Cerevisiae), TOPBP1-Interacting Checkpoint And Replication Regulator, TOPBP1-Interacting Replication-Stimulating Protein, TopBP1-Interacting, Replication-Stimulating Protein, Treslin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 90381
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TICRR
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DIGVVEESPEKGDEISLRRSPRIKQLSFSRTHSASFYSVSQPKSRSVQRVHSFQQDKSDQRENSPVQSIRSPKSLLFGAMSEMISPSE
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only