Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TIGD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TIGD3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TIGD3 Polyclonal specifically detects TIGD3 in Human samples. It is validated for Western Blot.Specifications
TIGD3 | |
Polyclonal | |
Rabbit | |
Human | |
220359 | |
Synthetic peptides corresponding to TIGD3(tigger transposable element derived 3) The peptide sequence was selected from the middle region of TIGD3. Peptide sequence FVDLEGEEPRSGVCKEEIGTEDEKGDREGAFEPLPTKADALRALGTLRRW. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
tigger transposable element derived 3, tigger transposable element-derived protein 3 | |
TIGD3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title