Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TIGD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TIGD4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TIGD4 Polyclonal specifically detects TIGD4 in Human samples. It is validated for Western Blot.Specifications
TIGD4 | |
Polyclonal | |
Rabbit | |
Q8IY51 | |
201798 | |
Synthetic peptides corresponding to TIGD4(tigger transposable element derived 4) The peptide sequence was selected from the N terminal of TIGD4. Peptide sequence RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MGC43837, tigger transposable element derived 4, tigger transposable element-derived protein 4 | |
TIGD4 | |
IgG | |
57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title