Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Tight Junction Protein 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 9 publications
Supplier: Novus Biologicals NBP185047
Description
Tight Junction Protein 1 Polyclonal specifically detects Tight Junction Protein 1 in Human, Mouse, Rat, Porcine samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Tight Junction Protein 1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Simple Western, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| DKFZp686M05161, MGC133289, Tight junction protein 1, tight junction protein 1 (zona occludens 1), tight junction protein ZO-1, TJP1, ZO1, ZO-1, zona occludens 1, Zona occludens protein 1, zonula occludens 1 protein, Zonula occludens protein 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 7082 | |
| Human, Mouse, Rat, Pig | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TJP1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED | |
| 0.1 mL | |
| Primary | |
| Specificity of human Tight Junction Protein 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction