Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Tight Junction Protein 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications
$416.50 - $670.00
Specifications
Antigen | Tight Junction Protein 2 |
---|---|
Dilution | Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunoprecipitation -Validated from a verified customer review, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Tight Junction Protein 2 Polyclonal specifically detects Tight Junction Protein 2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.Specifications
Tight Junction Protein 2 | |
Polyclonal | |
Rabbit | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
9414 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunoprecipitation -Validated from a verified customer review, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Unconjugated | |
RUO | |
C9DUPq21.11, DFNA51, DUP9q21.11, MGC26306, Tight junction protein 2, tight junction protein 2 (zona occludens 2), TJP2, X104, X104tight junction protein ZO-2, ZO2, ZO-2, ZO2Friedreich ataxia region gene X104 (tight junction protein ZO-2), Zona occludens protein 2, Zonula occludens protein 2 | |
TJP2 | |
IgG | |
Affinity Purified | |
Specificity of human Tight Junction Protein 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title