Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TIMM8A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$377.03 - $665.78

Specifications

Antigen	TIMM8A
Dilution	Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB432714 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP18428825UL	25 μL	Each for $377.03	Only null left	Sign In or Register to check your price. Add to Cart

NBP184288 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP184288	0.1 mL	Each for $665.78	Only null left	Sign In or Register to check your price. Add to Cart

Description

TIMM8A Polyclonal specifically detects TIMM8A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	TIMM8A
Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Accession No.	O60220
Gene ID (Entrez)	1678
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:GLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSK
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Molecular Weight of Antigen	11 kDa

Dilution	Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Core ESC Like Genes, Neuroscience, Stem Cell Markers
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	DDP1deafness/dystonia peptide, DDPMGC12262, Deafness dystonia protein 1, DFN1, mitochondrial import inner membrane translocase subunit Tim8 A, MTSTIM8, TIM8A, translocase of inner mitochondrial membrane 8 (yeast) homolog A, translocase of inner mitochondrial membrane 8 homolog A (yeast), X-linked deafness dystonia protein
Gene Symbols	TIMM8A
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

TIMM8A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents