Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TIP120A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | TIP120A |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TIP120A Polyclonal specifically detects TIP120A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TIP120A | |
Polyclonal | |
Rabbit | |
Human | |
Q86VP6 | |
55832 | |
This antibody was developed against a recombinant protein corresponding to amino acids: QTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPG | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
cullin-associated and neddylation-dissociated 1, Cullin-associated and neddylation-dissociated protein 1, cullin-associated NEDD8-dissociated protein 1, DKFZp434M1414, FLJ90441, KIAA0829FLJ10114, p120 CAND1, TBP interacting protein, TBP-interacting protein 120A, TBP-interacting protein of 120 kDa A, TIP120AFLJ38691, TIP120FLJ10929 | |
CAND1 | |
IgG | |
Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title