TIP30 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188170

Catalog No. NBP188170

Description

TIP30 Polyclonal specifically detects TIP30 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TIP30
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20
• Gene Alias: 30 kDa HIV-1 TAT-interacting protein, CC3oxidoreductase HTATIP2, EC 1.1.1, EC 1.1.1.-, FLJ26963, HIV-1 Tat interactive protein 2, 30 kDa, HIV-1 Tat interactive protein 2, 30kDa, HIV-1 TAT-interactive protein 2, SDR44U1, Tat-interacting protein (30kD), TIP30short chain dehydrogenase/reductase family 44U, member 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: HTATIP2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFC
• Quantity: 0.1 mL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 10553
• Target Species: Human
• Isotype: IgG

For Research Use Only