Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

For use in research applications

Supplier: Novus Biologicals™ NBP2293315MG

View more versions of this product

Catalog No. NBP2293315

$1,452.00 / Each of 1

Qty

Add to Cart

Specifications

Host Species	Human, Mouse
For Use With (Application)	Inhibition of TIRAP binding to TLR2 or TLR4
Quantity	5 mg
Molecular Weight (g/mol)	3701.4
Form	Lyophilized

Components	TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type	TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Inhibitors	TLR2, TLR4

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Description

Specifications

Product Suggestions

Documents

Promotions