Components |
ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 |
Content And Storage |
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
Inhibitors |
ERK1 |
Host Species |
Human, Mouse, Rat, Hamster, Rabbit, Xenopus |
Form |
Lyophilized |
Product Type |
ERK1 Inhibitor Peptide Set |
Molecular Weight (g/mol) |
3795 |
For Use With (Application) |
Inhibition of Erk activation |