Learn More
Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Applications: Flow Cytometry, In vitro assay
Supplier: Novus Biologicals™ NBP226245
Description
TLR2 / TLR4 Inhibitor Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da ; Antennapedia Control Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da
Specifications
White | |
Inhibit TLR2 and TLR4 signaling | |
1 mg | |
TLR2 and TLR4 |
TLR2 / TLR4 Inhibitor Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da ; Antennapedia Control Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da | |
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
TIRAP (TLR2 and TLR4) Inhibitor Peptide Set | |
Solid |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
For Research Use Only