Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Custom Products and Services
  4. Custom Enzymes and Inhibitors
  5. R&D Systems™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

R&D Systems™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
SDP

Catalog No. NBP2293315 Shop All Novus Products
Change view
Click to view available options
Quantity:
2 mg
5 mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP2293315 5 mg
NBP229331 2 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP2293315 Supplier R&D Systems™ Supplier No. NBP2293315MG

Customers require a valid business account associated to their profile to access pricing and ordering options.

missing translation for 'validMainframeMsg'

Description

A Novus product, part of R&D Systems. For use in research applications

Specifications

Host Species Human, Mouse
Components TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
For Use With (Application) Inhibition of TIRAP binding to TLR2 or TLR4
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Quantity 5 mg
Product Type TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Molecular Weight (g/mol) 3701.4
Product Line Novus
Inhibitors TLR2, TLR4
Form Lyophilized

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.