Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TJAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
| Antigen | TJAP1 |
|---|---|
| Dilution | Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:200-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TJAP1 Polyclonal specifically detects TJAP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TJAP1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZp686F06131, PILTTJP4tight junction protein 4 (peripheral), Protein incorporated later into tight junctions, tight junction associated protein 1 (peripheral), Tight junction protein 4, tight junction-associated protein 1 | |
| TJAP1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:200-1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q5JTD0 | |
| 93643 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVRKHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEKPESLLLNSAQS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title