Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TL1A/TNFSF15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | TL1A/TNFSF15 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TL1A/TNFSF15 Polyclonal specifically detects TL1A/TNFSF15 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
TL1A/TNFSF15 | |
Polyclonal | |
Rabbit | |
Apoptosis, Cell Cycle and Replication | |
MGC129934, MGC129935, TL1A, TL1Vascular endothelial cell growth inhibitor, TNF superfamily ligand TL1A, tumor necrosis factor (ligand) superfamily, member 15, tumor necrosis factor ligand superfamily member 15, vascular endothelial growth inhibitor-192A, VEGI192A, VEGITNF ligand-related molecule 1 | |
TNFSF15 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
9966 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title