Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TLR6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications
$487.50
Specifications
Antigen | TLR6 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TLR6 Polyclonal specifically detects TLR6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifications
TLR6 | |
Polyclonal | |
Rabbit | |
Adaptive Immunity, Cytokine Research, Immunology, Innate Immunity, Prostate Cancer, Toll Like Receptors | |
CD286, CD286 antigen, toll-like receptor 6 | |
TLR6 | |
IgG | |
53 kDa |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
Unconjugated | |
RUO | |
Q2NKL3 | |
10333 | |
Synthetic peptides corresponding to TLR6(toll-like receptor 6) The peptide sequence was selected from the middle region of TLR6. Peptide sequence KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title