Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TLR6 Antibody, Novus Biologicals™
SDP

Catalog No. p-7106387 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154336 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP154336 Supplier Novus Biologicals Supplier No. NBP154336
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 3 publications

TLR6 Polyclonal specifically detects TLR6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

Antigen TLR6
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q2NKL3
Gene Alias CD286, CD286 antigen, toll-like receptor 6
Gene Symbols TLR6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TLR6(toll-like receptor 6) The peptide sequence was selected from the middle region of TLR6. Peptide sequence KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT.
Molecular Weight of Antigen 53 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Adaptive Immunity, Cytokine Research, Immunology, Innate Immunity, Prostate Cancer, Toll Like Receptors
Primary or Secondary Primary
Gene ID (Entrez) 10333
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Goat, Sheep
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.