Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TLR6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
$436.00
Specifications
Antigen | TLR6 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP154336
|
Novus Biologicals
NBP154336 |
100 μL |
Each of 1 for $436.00
|
|
Description
TLR6 Polyclonal specifically detects TLR6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifications
TLR6 | |
Polyclonal | |
Rabbit | |
Adaptive Immunity, Cytokine Research, Immunology, Innate Immunity, Prostate Cancer, Toll Like Receptors | |
CD286, CD286 antigen, toll-like receptor 6 | |
TLR6 | |
IgG | |
Affinity Purified | |
53 kDa |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
Unconjugated | |
RUO | |
Q2NKL3 | |
10333 | |
Synthetic peptides corresponding to TLR6(toll-like receptor 6) The peptide sequence was selected from the middle region of TLR6. Peptide sequence KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title