Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TM4SF20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15984820UL
Description
TM4SF20 Polyclonal specifically detects TM4SF20 in Human samples. It is validated for Western Blot.Specifications
TM4SF20 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q53R12 | |
TM4SF20 | |
Synthetic peptides corresponding to TM4SF20 (transmembrane 4 L six family member 20) The peptide sequence was selected from the middle region of TM4SF20)(50ug). Peptide sequence QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG. | |
Affinity Purified | |
RUO | |
79853 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ22800, PRO994, TCCE518, transmembrane 4 L six family member 20, transmembrane 4 L6 family member 20 | |
Rabbit | |
25 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction