Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TM4SF20 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $499.50
Specifications
| Antigen | TM4SF20 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15984820
|
Novus Biologicals
NBP15984820UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP159848
|
Novus Biologicals
NBP159848 |
100 μL |
Each for $499.50
|
|
|||||
Description
TM4SF20 Polyclonal specifically detects TM4SF20 in Human samples. It is validated for Western Blot.Specifications
| TM4SF20 | |
| Polyclonal | |
| Rabbit | |
| Q53R12 | |
| 79853 | |
| Synthetic peptides corresponding to TM4SF20 (transmembrane 4 L six family member 20) The peptide sequence was selected from the middle region of TM4SF20)(50ug). Peptide sequence QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ22800, PRO994, TCCE518, transmembrane 4 L six family member 20, transmembrane 4 L6 family member 20 | |
| TM4SF20 | |
| IgG | |
| 25 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title