Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMCC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TMCC1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TMCC1 Polyclonal specifically detects TMCC1 in Human samples. It is validated for Western Blot.Specifications
TMCC1 | |
Polyclonal | |
Rabbit | |
Q6N039 | |
23023 | |
Synthetic peptides corresponding to TMCC1(transmembrane and coiled-coil domain family 1) The peptide sequence was selected from the middle region of TMCC1. Peptide sequence YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp686M0169, FLJ42680, KIAA0779, transmembrane and coiled-coil domain family 1, transmembrane and coiled-coil domains 1, transmembrane and coiled-coil domains protein 1 | |
TMCC1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title